Scaffold Ga0207884_1039661

Overview

Basic Information

• Taxon OID: 3300025236
• Scaffold ID: Ga0207884_1039661
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-144 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 792
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 29.1475
  • Long. (^o): -23.6838

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005894	Metagenome / Metatranscriptome	387	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207884_10396612	F005894	GGAG	VASLLDHSFPIVPEEYDVDTFTRIMRDLEIALTKFDFPAVISGEDDTKGLSWFME