Scaffold Ga0207884_1024673

Overview

Basic Information

• Taxon OID: 3300025236
• Scaffold ID: Ga0207884_1024673
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-144 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1072
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 29.1475
  • Long. (^o): -23.6838

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081441	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207884_10246732	F081441	AGGA	MVLSSREKFVAFYSMFLTTHIGLGVNPAELDGDGMGQVFNAVLETVRKSTCPDVSEDEVKAIAEDFNIEMFKIRTVLDEAVKSQRLGDRV