Scaffold Ga0208837_1024499

Overview

Basic Information

• Taxon OID: 3300025234
• Scaffold ID: Ga0208837_1024499
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0327 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Recife, Brazil, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -9.12
  • Long. (^o): -30.19
  • Depth (m): 4001.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023718	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208837_10244992	F023718	GAG	MKEKIDLSLNRSLEELISSYWEAENEGTESSDFYVLENYLSDMGAL