| Basic Information | |
|---|---|
| Taxon OID | 3300025221 Open in IMG/M |
| Scaffold ID | Ga0208336_1007655 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Deep Atlantic Ocean - MP0372 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2303 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East of Porto Seguro, South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -15.83 | Long. (o) | -33.41 | Alt. (m) | Depth (m) | 4003.17 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054935 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208336_10076552 | F054935 | N/A | MKRRTFIKYTSLISTAVFLPLAQLFGAKPKPKNPFTTFDFNLPLQGSPFRKNCDSLDNYNDISFKTMMEDIVHYRTPAKLRDKLILGIKTKGE |
| ⦗Top⦘ |