Basic Information | |
---|---|
Taxon OID | 3300025221 Open in IMG/M |
Scaffold ID | Ga0208336_1002826 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Deep Atlantic Ocean - MP0372 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4696 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East of Porto Seguro, South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -15.83 | Long. (o) | -33.41 | Alt. (m) | Depth (m) | 4003.17 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040684 | Metagenome / Metatranscriptome | 161 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208336_10028265 | F040684 | AGAAGG | MKRVIYLIILAMSLTLVFSQGKPCCKNKSGKGKVACKFNRANIDVNKDGTVIEDGTQIAAAGVQCPLSAQNTSINKKNCTNCAKSPWWKFWGKKKGCCNTNS |
⦗Top⦘ |