Basic Information | |
---|---|
Taxon OID | 3300025216 Open in IMG/M |
Scaffold ID | Ga0207883_1022119 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Deep Pacific Ocean - MSP-109 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 843 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.064 | Long. (o) | -133.3152 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031260 | Metagenome / Metatranscriptome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207883_10221191 | F031260 | N/A | WFNSAKPGDKYTYFIGNLACEAERIDGYPLRQLRKHIMDKCCKWDLDPLPKKKTDNKIIFRSSMRLVQKAHPKYWDKKEKEILNGADYIAVKL |
⦗Top⦘ |