NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208329_1002715

Scaffold Ga0208329_1002715


Overview

Basic Information
Taxon OID3300025211 Open in IMG/M
Scaffold IDGa0208329_1002715 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Pacific Ocean - MP2053 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3137
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameWest of Cabo San Lucas, Mexico, North Pacific Ocean
CoordinatesLat. (o)14.53Long. (o)-118.77Alt. (m)Depth (m)4004.97
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082562Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0208329_10027152F082562AGGVIKYIIGILITLSNILFAQVSEDSNNCFLNIELSLIHPILGGFGGTIGIEKNKFSYGLNSFGTKLNHMTKHYLLVNAEELAVYNWGVELYSDYYLKQNHAGIFLGLISSLNGFRFNDTPIPQTILVVYSVPRIGYRAYLPKKLKSFYFQFSLTTHFKVWNNKKKILYQEIDTKSIFLISQLTLGMKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.