Scaffold Ga0207913_1036432

Overview

Basic Information

• Taxon OID: 3300025188
• Scaffold ID: Ga0207913_1036432
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP2913 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 700
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of Santa Cruz de la Palma, Atlantic Ocean
• Coordinates
  • Lat. (^o): 29.97
  • Long. (^o): -23.69
  • Depth (m): 4003.49

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016284	Metagenome / Metatranscriptome	248	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207913_10364321	F016284	AGGA	MTSKTLKDMRKELLDKYSGKLTGYEHLADGTGEYAKIVPKDTEKESEETSEKT