Scaffold Ga0207913_1003805

Overview

Basic Information

• Taxon OID: 3300025188
• Scaffold ID: Ga0207913_1003805
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP2913 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3785
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of Santa Cruz de la Palma, Atlantic Ocean
• Coordinates
  • Lat. (^o): 29.97
  • Long. (^o): -23.69
  • Depth (m): 4003.49

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053221	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207913_10038054	F053221	GGAG	MSVIDQTNNKVTPAAPAAPADMPRDKAGNIAYECGNFFQSQSQGHSDGLPRPPHAHEPRSWASLLVDPDILSLPAPAWQQPGYRYGLIGRLHAGPYFELGYNGHCYACDAHFLEFAWAQEHKCTEEQAFRDVTRRFVRDYRALRKAARQAPAPLPKREKGILARLLRMFTGR