Scaffold Ga0209337_1353511

Overview

Basic Information

• Taxon OID: 3300025168
• Scaffold ID: Ga0209337_1353511
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.5666
  • Long. (^o): -138.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044148	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209337_13535111	F044148	N/A	MADKAEDNDTKQEVLDDVLDDYGLTEAYTDLRGDGDEGTTTSDTDKDYGLHQFSDPKYVPAYTDQSFQTAPDKTGIGQDLGDKQSGTPKKAKGQATATKSSAKVDAKGGMDKPAVGTKSDTPDKAVGKAAAAKIAPRVTTKDGVATQKEEVELDERAKGDSIEGPAK