NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209521_10022659

Scaffold Ga0209521_10022659


Overview

Basic Information
Taxon OID3300025164 Open in IMG/M
Scaffold IDGa0209521_10022659 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado, USA - sediment 19ft 4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4456
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (45.45%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008501Metagenome332Y

Sequences

Protein IDFamilyRBSSequence
Ga0209521_100226592F008501N/AMQKLMIDKKGAVDLTELAIGIVVLGITVSVGATILVNVRDTNTVNTTAYNLSNSAAVGLGEYGNWFKILVITGIAAVVLGLIFMAFGRADGGGGVTKY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.