Basic Information | |
---|---|
Taxon OID | 3300025162 Open in IMG/M |
Scaffold ID | Ga0209083_1042836 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1999 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Lake Alinen Mustajarvi | |||||||
Coordinates | Lat. (o) | 61.2 | Long. (o) | 25.1 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062386 | Metagenome / Metatranscriptome | 130 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209083_10428365 | F062386 | GAG | MHTQLVHEATKDRINVSITSDGGKNTVYLVTGTILHEDDSVFDIINIKKLAGNPTNIRLDSILFMVEKDLKVFVTYRNQPYIIPIDGKGKTDLSWVGGLTGHEIDMVFKGTGSFFIVLDVSKMGV |
⦗Top⦘ |