Scaffold Ga0209083_1028549

Overview

Basic Information

• Taxon OID: 3300025162
• Scaffold ID: Ga0209083_1028549
• Source Dataset Name: Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2638
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Lake Alinen Mustajarvi
• Coordinates
  • Lat. (^o): 61.2
  • Long. (^o): 25.1
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104341	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209083_10285494	F104341	N/A	MWKLISIFRVWFQGFLAIEVAIHVKDLISGHFFWQVCLGAFVPVIIRWATPQDQFPDEKL