NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209619_10309003

Scaffold Ga0209619_10309003


Overview

Basic Information
Taxon OID3300025159 Open in IMG/M
Scaffold IDGa0209619_10309003 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado, USA - sediment 16ft 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)840
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003485Metagenome / Metatranscriptome484Y
F007547Metagenome / Metatranscriptome349Y

Sequences

Protein IDFamilyRBSSequence
Ga0209619_103090032F003485GAGMAAKVSLSVEVQGDDIVVTLPGTSYVVTHYRATAFPQQLLTKSHSGREDQGAPMTQAEFHARAWKAANTKARELGWIV
Ga0209619_103090033F007547GGAGGMQPLPPQLELPEGDRFTLPTVSAVRELVPPGGQLPAHMVLMMICGKELWVPLEREIARQMANILAPFRE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.