NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209645_1072605

Scaffold Ga0209645_1072605


Overview

Basic Information
Taxon OID3300025151 Open in IMG/M
Scaffold IDGa0209645_1072605 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1158
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007584Metagenome / Metatranscriptome348Y
F024547Metagenome / Metatranscriptome205Y
F025719Metagenome / Metatranscriptome200N

Sequences

Protein IDFamilyRBSSequence
Ga0209645_10726052F025719AGGMKETNAQTVIEKLREAVYFSICYKPKKYNGRPVYRNAKWDDKCKIGNGYIIYYDRDRGGYRCASGESAISLQKGELNNG
Ga0209645_10726053F007584GGAGMAETIARLLMILIGFAVAMLGIIYAIHSQDTYLGILISVGGVASMLGGLPQ
Ga0209645_10726055F024547AGGAMKPKNLAETIDNNDYTRRNRFTGESIELTKEEADKHDKIFYYEALATLEDK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.