Scaffold Ga0209645_1059140

Overview

Basic Information

• Taxon OID: 3300025151
• Scaffold ID: Ga0209645_1059140
• Source Dataset Name: Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1322
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 18.92
  • Long. (^o): -104.89

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020817	Metagenome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209645_10591402	F020817	N/A	MVHNNMMYLILKERHYSNIDNSYDIVASSTDVDVINDKLKGYQLINDDKNNTYSIVRYESPLLLTEEVA