Scaffold Ga0209511_1143479

Overview

Basic Information

• Taxon OID: 3300025147
• Scaffold ID: Ga0209511_1143479
• Source Dataset Name: Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 936
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Borup Fiord, Nunavut, Canada
• Coordinates
  • Lat. (^o): 81.017
  • Long. (^o): -81.583
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093312	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209511_11434792	F093312	N/A	ALVSADGILPGFSSKLRLLVINLVSVPGGQLVNSPTAQSLERYAQFDCKFQLLAQLF