| Basic Information | |
|---|---|
| Taxon OID | 3300025142 Open in IMG/M |
| Scaffold ID | Ga0210019_1046634 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from aquifer - Crystal Geyser CG11_big_fil_rev_8/21/14_0.20 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2427 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah: Grand County | |||||||
| Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043249 | Metagenome / Metatranscriptome | 156 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210019_10466341 | F043249 | N/A | LIRVDGSGDLRQGNVGVFGAVQSRSQLFVRQGADVAVSNLTTGGFFPSDQTFVTLAVRVWTYFRFNVESQRTDAQNTTGPVASLAGVTADRIQRVHKLYHQAENQLFWQFIAGDKPQLTTFTAYTPAAGGLDGFFSDTRLPRANNGVPTSAALMRLARPILVPPRQGFQVVAIASPIGQAQGASIIEQLNGAVPNNDPWGASSTGGTVTGTVGTNGLTTTGRDDIEKDIKYLIDGIHSRDVL |
| ⦗Top⦘ |