NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209756_1044326

Scaffold Ga0209756_1044326


Overview

Basic Information
Taxon OID3300025141 Open in IMG/M
Scaffold IDGa0209756_1044326 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2232
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)85
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067096Metagenome / Metatranscriptome126Y
F068923Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0209756_10443261F067096AGGAGGMATYKSSAGAVLQPGNQINRLSGFNDEGVFGLPGVEAFELLGYAKVSNLTA
Ga0209756_10443265F068923N/APQDFWNNFGSAADRDPQNAWRYLNAAQQSPEIFRQKLLVME

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.