NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209634_1200143

Scaffold Ga0209634_1200143


Overview

Basic Information
Taxon OID3300025138 Open in IMG/M
Scaffold IDGa0209634_1200143 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-40 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)765
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003514Metagenome / Metatranscriptome482Y
F004191Metagenome / Metatranscriptome449Y

Sequences

Protein IDFamilyRBSSequence
Ga0209634_12001432F004191AGGAGMNKFKEIMATWFAVLGILAFIFSVGAVEADNYMIAFVLFVIGISTMFISIVCQENQ
Ga0209634_12001433F003514AGGAGMFTIEEYNTAEQYNKLREEELILKAAKSSGANKSEMIHGSLFVTFTPGFVDVLSQELKGVLEKLLDNTKVKMYNINNGEYAYDFI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.