Basic Information | |
---|---|
Taxon OID | 3300025138 Open in IMG/M |
Scaffold ID | Ga0209634_1039769 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2408 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002151 | Metagenome / Metatranscriptome | 589 | Y |
F024560 | Metagenome / Metatranscriptome | 205 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209634_10397691 | F024560 | N/A | DISPFTSLFGGGQSIPKNQMGPAVTVNTQGPQETSSSGELLGASLGLGGALLTQGAKFLKSPAGGSLLGLGAGALGASMGSGSGSAPRITRRMKSDVRRIYMMSGMNPNITAQILNNMGTYPRFDFNASLVFFILTKRFRNDGPVVTKAAVRKTRTTLRRMKGVVDTYNSVCKPTTRRAPMKRATRSAVQLIKN |
Ga0209634_10397694 | F002151 | N/A | MEFAYLIALACSIAALAVSLIAGARVGKFVKSTSDTDWETLANLTGDIAALKRTCQTLNNRLNGMNKATVPQDQIIQQMLDHQNVEQIRRGG |
⦗Top⦘ |