NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209336_10193844

Scaffold Ga0209336_10193844


Overview

Basic Information
Taxon OID3300025137 Open in IMG/M
Scaffold IDGa0209336_10193844 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-32 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.2833Long. (o)-134.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007947Metagenome / Metatranscriptome342Y
F011124Metagenome / Metatranscriptome295Y
F074150Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0209336_101938441F011124AGGAGMFDPDKTYGITVWDMSVAVVDVEADDYVRNEDGSIKLFDIPNYDYSYICDGIDVDDLHERDE
Ga0209336_101938442F074150AGGAGMTTYEVTRSYTVACVATIEAESADQAKIIALNFDGIHWKEYDGDYEADITVEEIDNV
Ga0209336_101938443F007947N/ASLTMLNCNTILCLQNQMPDMGLDDLLVIGYLVGGLAVIIYLVMDALKEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.