Scaffold Ga0209336_10136754

Overview

Basic Information

• Taxon OID: 3300025137
• Scaffold ID: Ga0209336_10136754
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 658
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C165 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.2833
  • Long. (^o): -134.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008877	Metagenome	326	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209336_101367543	F008877	GGGGG	MMKAKYFVSVLKILKDKYGFSFNINDTMQQVEDKLDDVNTFRYTTKTNGSHLLPGNVVNFLNEKEKKLKGDK