NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209498_1083620

Scaffold Ga0209498_1083620


Overview

Basic Information
Taxon OID3300025135 Open in IMG/M
Scaffold IDGa0209498_1083620 Open in IMG/M
Source Dataset NameLake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1337
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Hawthorne, Nevada
CoordinatesLat. (o)38.7Long. (o)-118.7Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017273Metagenome / Metatranscriptome241Y
F040081Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0209498_10836201F040081AGGLDPITLLATASAIWSGLKKASEFAAEAEGVWGQLSKYCGVADQLEQHITDAKNKPQKPKLFQKLDFSNDTQEAFNAFEAEHKLMEMEKEIRHEFLYGAFCNLEGGYGSLDGYRKFLEMRRKIRADRIRMKQEQE
Ga0209498_10836202F017273AGGAGMPGMMMMKDKKAKPMSYKKGGMVFKPCPGCPNTAKCKAMGKCMKKAKGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.