NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209232_1192334

Scaffold Ga0209232_1192334


Overview

Basic Information
Taxon OID3300025132 Open in IMG/M
Scaffold IDGa0209232_1192334 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)627
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002146Metagenome590Y
F057389Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0209232_11923342F002146GAGGMIKNILNFLLWKKEEIFSFLDYVLFLAMMYFCYLGLKYADQINQLIIELKGGVI
Ga0209232_11923343F057389N/AYKSAYKTTTFVEDKKINVVHHATKIIEHDVENNTIKLNNGGWYSKTTKDRMHSYLIENASYRLYQQKGNWFVDQVDKLNDYKTIKTIPYENNMILRVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.