Scaffold Ga0208919_1090137

Overview

Basic Information

• Taxon OID: 3300025128
• Scaffold ID: Ga0208919_1090137
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 996
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -13.003
  • Long. (^o): -80.809
  • Depth (m): 90

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037425	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208919_10901373	F037425	GGA	MAWDDFRKQYQGIIKNLLNNVDICNERYAKEGDEGYLVQRKVYIKEIEEIKTMIKKKELELGYYKESNDNNEN