Basic Information | |
---|---|
Taxon OID | 3300025128 Open in IMG/M |
Scaffold ID | Ga0208919_1076231 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1106 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | -13.003 | Long. (o) | -80.809 | Alt. (m) | Depth (m) | 90 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022426 | Metagenome | 214 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208919_10762313 | F022426 | N/A | LLVMPTDPPDVKKRFPLFTGKQKAELIKRWIDASNKFLLKNKKKIKKSFEDNVNNPKITKFMSSYGYNELLVYDVKVKDAYIVIDIVGDPNDYDATEKALKQVKKDLKPFVKGKIYQGFASGVKKFVKQRGGKV |
⦗Top⦘ |