NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209348_1020987

Scaffold Ga0209348_1020987


Overview

Basic Information
Taxon OID3300025127 Open in IMG/M
Scaffold IDGa0209348_1020987 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2441
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025518Metagenome / Metatranscriptome201Y
F028529Metagenome / Metatranscriptome191N
F049702Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0209348_10209872F028529GGGGGMRLSKFLTEDLDTKTVNLTLTFDERTELLKHLEVYDEHIDQLHPLVESVQDKLLGID
Ga0209348_10209877F049702N/AMTLIDFDKKELHDIYSALQYSRLETGFENESEAELYDRLTKLMDKVAKLRQVCNCQENVSNDT
Ga0209348_10209878F025518N/AMSEEKLTHYTKTSLREESKLYLPTVREFYPHLDGMLTDRIAKYCAIYSKGTDKASIRQAINDFEEVFDQELTQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.