NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209348_1018483

Scaffold Ga0209348_1018483


Overview

Basic Information
Taxon OID3300025127 Open in IMG/M
Scaffold IDGa0209348_1018483 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2644
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036270Metagenome170Y
F062820Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0209348_10184834F062820GAGGMTTSTWKHIDIGSICVHCGKDTAYGHSDMLFVDRIPADADLLDDDGNPIGTKEGYACRECIYVDEDDFFHEDNVSD
Ga0209348_10184836F036270GGAGGMHIESTDKQGVFKACKEGHRLLELINDMGWDYDRFSSSGQETYDKICVILGTVEED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.