NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209535_1038095

Scaffold Ga0209535_1038095


Overview

Basic Information
Taxon OID3300025120 Open in IMG/M
Scaffold IDGa0209535_1038095 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-28 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2182
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)48.9699Long. (o)-130.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006271Metagenome / Metatranscriptome377Y
F065936Metagenome / Metatranscriptome127Y
F071648Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0209535_10380953F006271N/AMMIYGNTPRDIRKMMWRRKYKLLTLIMAIAVAVMLMGCQVGSKKVNPPLMALEKFWDTLGSGENKTKKDSTDVE
Ga0209535_10380955F065936AGGAGMMTAEQGFGMLLMGIIVLTIAGTIMFLVINGIETNKIKREQERKQREKIDGLN
Ga0209535_10380958F071648N/AISGCHDNVRGGLLVKRTFACTVCGKKFTHQKPDTLVGKLGIIPVNLCKTHFKAVMKHDELMLNDHRKVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.