NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209535_1008817

Scaffold Ga0209535_1008817


Overview

Basic Information
Taxon OID3300025120 Open in IMG/M
Scaffold IDGa0209535_1008817 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-28 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5841
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)48.9699Long. (o)-130.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018831Metagenome / Metatranscriptome233Y
F018932Metagenome / Metatranscriptome232Y
F031501Metagenome / Metatranscriptome182N

Sequences

Protein IDFamilyRBSSequence
Ga0209535_10088171F031501GAGMTNELIDLFEEAKRIIDKQEELIKMQMNVIKTMQTALEGVELNELLLKKQLADIQEELISITNDYIDVKGGA
Ga0209535_10088174F018831AGAAGMKIIASISIELDIEDTELLDEAKDRAIDTLIDRIDDWMNNNGIPPIISIDYRIPEIGDDDNIFLN
Ga0209535_10088176F018932N/ALNPNRATRHQEIWKRTKNGLELLLPKKINSDIGFQLMFGHREDYRIEEKRIEDNAEKYECKTYINVNDFKKYI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.