Basic Information | |
---|---|
Taxon OID | 3300025115 Open in IMG/M |
Scaffold ID | Ga0209835_1044264 Open in IMG/M |
Source Dataset Name | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1266 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rwanda: Lake Kivu | |||||||
Coordinates | Lat. (o) | -1.78 | Long. (o) | 29.2 | Alt. (m) | Depth (m) | 52 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012571 | Metagenome | 279 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209835_10442643 | F012571 | N/A | MTDNIKNPDDVIGVCSECKSDQPMGYMYRNAFAQQGLAVPCKYCGGIVIITYRETRDSSLNSSDKDRGIG |
⦗Top⦘ |