| Basic Information | |
|---|---|
| Taxon OID | 3300025115 Open in IMG/M |
| Scaffold ID | Ga0209835_1009749 Open in IMG/M |
| Source Dataset Name | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3500 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rwanda: Lake Kivu | |||||||
| Coordinates | Lat. (o) | -1.78 | Long. (o) | 29.2 | Alt. (m) | Depth (m) | 52 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011148 | Metagenome / Metatranscriptome | 294 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209835_10097493 | F011148 | AGG | MAIFAKNSLTQVSGFDNPIIAGELVYQQQTYWNLQITGEDSNPVNLAGATIDAQIVRRTLTNVKDTRYGLSFDVGNYTPTPTAIPLTITNRDDALGKFTLVINDSSWGLVDSDAQMAINSVDGAGFSGRIKISFPSSSATPAEDNIIFLLFIVRSDGIVKV |
| ⦗Top⦘ |