Scaffold Ga0208158_1001727

Overview

Basic Information

• Taxon OID: 3300025110
• Scaffold ID: Ga0208158_1001727
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6967
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (93.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -11.499
  • Long. (^o): -81.401
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099841	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208158_100172714	F099841	AGGA	VSQIHGYLNSVPEDFGHRWSNNSDHTRVECQYCGDSYGSRRWCDNRLVVSEQDRDMDEAMSQYYSQEAE