Scaffold Ga0208013_1068761

Overview

Basic Information

• Taxon OID: 3300025103
• Scaffold ID: Ga0208013_1068761
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 930
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.51
  • Long. (^o): -76.2
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057748	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208013_10687613	F057748	N/A	MTKVYDFDWHRLQREDILRKSLGYSEDVWRLMKDAGYNVTDQEDRDQFFKDLGDVDQ