NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208013_1001610

Scaffold Ga0208013_1001610


Overview

Basic Information
Taxon OID3300025103 Open in IMG/M
Scaffold IDGa0208013_1001610 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10271
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031648Metagenome182Y
F062151Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0208013_100161012F031648AGGMVEYNHNAVSFNADTTIKGNHGVIVSVYVSKSGSSGSKCIFKNGTSSSGGAEFTIFSEEQGTYVGINRRFEDGIFADITGNAEYTVVFK
Ga0208013_10016109F062151N/AMSSFIYDAATTVINILNDNWSAGQVPEITKAWKKRSVGFVDDRRDQIVITPKAEKIQYFGLYGDDHWHDITIDLDIRTYQDDERHNDIVKESIRILTAKIRGGTDYTDLRVISSYTRNQYMRNMFNHILTVSIRKTNPS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.