Scaffold Ga0208159_1016268

Overview

Basic Information

• Taxon OID: 3300025101
• Scaffold ID: Ga0208159_1016268
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1873
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.198
  • Long. (^o): -77.499
  • Depth (m): 38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053631	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208159_10162685	F053631	GGAGG	MIRAIYFSLCFCLAMFGLLVVSQIDTTTGLSMFALFIVKFILMLPKYQGE