Scaffold Ga0208669_1003266

Overview

Basic Information

• Taxon OID: 3300025099
• Scaffold ID: Ga0208669_1003266
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5365
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -16.21
  • Long. (^o): -76.63
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052261	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208669_10032664	F052261	N/A	MEEASVSCVFDERATRALHSAVAYTLEKWTGQGEIDQEELFYLKTFLQGAIFEFDFGR