Scaffold Ga0208791_1000219

Overview

Basic Information

• Taxon OID: 3300025083
• Scaffold ID: Ga0208791_1000219
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 29796
• Total Scaffold Genes: 34
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (20.59%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.205
  • Long. (^o): -77.515
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007526	Metagenome / Metatranscriptome	349	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208791_100021924	F007526	N/A	MTREELKHLWFNLPHPTPKKEVRVIKVSKLGENHYECKKVRDDKNGYSTYSSNWKTFDEALEFARKLMKDTPEFSIIIN