Scaffold Ga0208156_1047626

Overview

Basic Information

• Taxon OID: 3300025082
• Scaffold ID: Ga0208156_1047626
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 869
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -13.003
  • Long. (^o): -80.809
  • Depth (m): 275

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086172	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208156_10476261	F086172	N/A	MDRIYQEAVNGRIQYHSEEIGRIKECGGREPIWSEERPLFKRRRGNTRFEPFGCPSDTIGVYRIIYKPTMETLSIGCGVVTNRLSRHRLVFLNGGVDVPNPGGTTNGSATGGHMYKYDTYRKNWLFSWCSIGNKSLAEESEDLLIHSEEPEFNSKHMGGK