NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208156_1022179

Scaffold Ga0208156_1022179


Overview

Basic Information
Taxon OID3300025082 Open in IMG/M
Scaffold IDGa0208156_1022179 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1419
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-13.003Long. (o)-80.809Alt. (m)Depth (m)275
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005580Metagenome396Y

Sequences

Protein IDFamilyRBSSequence
Ga0208156_10221791F005580GGAMKKSIPHPSVTGMASGLAIAAYLNAGQTTTTPGKWGGQGTTKTIGEGVIKDITDGQLGEAFNTLSSNAINMIASDGGRKTLVTATSIALLGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.