NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207896_1003057

Scaffold Ga0207896_1003057


Overview

Basic Information
Taxon OID3300025071 Open in IMG/M
Scaffold IDGa0207896_1003057 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-36 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3155
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium TMED49(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024416Metagenome / Metatranscriptome206N
F052880Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0207896_10030573F024416AGGAGGMKIEVLMYNEEGQVVGKAIETACNSLIVNGVHVISNGGVNAEMRDLLGATTTQDIGMTLVPPLELN
Ga0207896_10030575F052880AGGAGMEKVEYCYVAKCLGMKCPRVWAQTREECEAAMQQWTAKQVRFKPLGLYKYPLIHKGENKYEIDWGYEDDNGTYNDNGQDVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.