Scaffold Ga0207887_1016738

Overview

Basic Information

• Taxon OID: 3300025069
• Scaffold ID: Ga0207887_1016738
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-38 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1148
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.9853
  • Long. (^o): -145.0838

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093988	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207887_10167382	F093988	N/A	MLPDTIYYKREKIKIRWMGRKESQDLDCVGMFVPDDNEILIYKNQSMKNVLITFLHELYHLLCSKDNINVGKCGEEKLVDKLSESFVRLLIHNPKLLGVFQKFLK