Scaffold Ga0208301_1021246

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208301_1021246

Scaffold Ga0208301_1021246

Overview

Basic Information
Taxon OID	3300025064 Open in IMG/M
Scaffold ID	Ga0208301_1021246 Open in IMG/M
Source Dataset Name	Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	878
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Caribbean Sea: Cariaco Basin
Coordinates	Lat. (^o)	10.847	Long. (^o)	-65.114	Alt. (m)		Depth (m)	247
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076491	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208301_10212462	F076491	GAG	MKIGDLITFKIDYDSECIEDIGIVTKIEPTLGYAIIAWPWGSERHRTCGLQVLSENGEQK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.