| Basic Information | |
|---|---|
| Taxon OID | 3300025064 Open in IMG/M |
| Scaffold ID | Ga0208301_1005515 Open in IMG/M |
| Source Dataset Name | Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2129 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Caribbean Sea: Cariaco Basin | |||||||
| Coordinates | Lat. (o) | 10.847 | Long. (o) | -65.114 | Alt. (m) | Depth (m) | 247 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019633 | Metagenome | 228 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208301_10055152 | F019633 | GGAGG | MNFLLKLLPADKRSLLELALRITASLDTTAERKRVADYGVEMLKDGKVSVGEWAKFGSKLGILKGKH |
| ⦗Top⦘ |