NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208300_108502

Scaffold Ga0208300_108502


Overview

Basic Information
Taxon OID3300025061 Open in IMG/M
Scaffold IDGa0208300_108502 Open in IMG/M
Source Dataset NameMarine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1682
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameCaribbean Sea: Cariaco Basin
CoordinatesLat. (o)10.847Long. (o)-65.114Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037762Metagenome / Metatranscriptome167N
F101007Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0208300_1085023F101007AGGAGMSMIVRHPFRNFFSSPFDVDWNEAYKQSMIPEDGTIIVQREMVEKKYRVKHESDGTVKYIPITEEVVDEPKN
Ga0208300_1085024F037762N/ARRVADRVGGKRIPITGRKGLDIDHPTLDIECKYRKQLPAWLFKKAWSQANEGSGIPVIAVGEYNSSDIFTIISLDTLVKLLNKEYN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.