NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207898_1027353

Scaffold Ga0207898_1027353


Overview

Basic Information
Taxon OID3300025049 Open in IMG/M
Scaffold IDGa0207898_1027353 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-55 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)723
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.567Long. (o)-138.6676Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049037Metagenome / Metatranscriptome147N
F060975Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0207898_10273531F049037N/APDFKLFYDTGKITHHDRSPNWYIDMPPHTITVRELSERCGFGKETNKLKHWLGLKVFKLIEDPLGFYFLRHLDGAIEDLHEGKSSKRLRYAKAACGQVVLEAKVREGASRTQNHLGRVVQRKMGRTVTTVRSDEDSSEEKHKKWVKLSETMW
Ga0207898_10273532F060975AGGAGMGKTIRNNVVAKHSEKFNKPKTIRDKKKDYYRPDVKRDFEEAIEDLSFDEDNRKNAIIIQYQDDLARSQEDGWPYED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.