Scaffold Ga0207905_1010701

Overview

Basic Information

• Taxon OID: 3300025048
• Scaffold ID: Ga0207905_1010701
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1605
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0003
  • Long. (^o): -144.9998

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033961	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207905_10107012	F033961	AGGAGG	MNKEKAINILLQHAIDSCEKIKIRKHAGYTEEVADDLTAAILFLEHNRNKEKQDAKVEITGLEFNLSKGA