Scaffold Ga0207905_1005696

Overview

Basic Information

• Taxon OID: 3300025048
• Scaffold ID: Ga0207905_1005696
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2328
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0003
  • Long. (^o): -144.9998

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102064	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207905_10056961	F102064	N/A	WRLEKGGKIMTYLIIKKFDLKSEFSKPSYHVETTTDNLALANKKLVALNLLNEDNKNYSFHIVELNEDVLVLTEDMQVA