Scaffold Ga0207897_121845

Overview

Basic Information

• Taxon OID: 3300025047
• Scaffold ID: Ga0207897_121845
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-42 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 685
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.9996
  • Long. (^o): -144.9998

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049222	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207897_1218451	F049222	N/A	MHEIKIEKHWGGKTYNVNLISWQGDEGVSFGRAFDVSKEKAEEVAKHQATLYNAEIIREEDK